PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0241200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 270aa    MW: 28492.5 Da    PI: 8.6071
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0241200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-13120164347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +W+++E+ l++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qk+
  ORGLA05G0241200.1 120 PWSEQEHRLFLAGLEKLGKGDWRGISRSFVTTRTPTQVASHAQKF 164
                        8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.439113169IPR017930Myb domain
SuperFamilySSF466892.47E-16114170IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-17116167IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.6E-10117160IPR009057Homeodomain-like
SMARTSM007173.8E-10117167IPR001005SANT/Myb domain
PfamPF002492.1E-10120163IPR001005SANT/Myb domain
CDDcd001675.01E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MHAIMARRCS GDYSTAGQRA GEEGGGGGGA GLRLFGVQLH AAAASSPASY LHKSYSMDCL  60
RLQVSSPSSL QSSSSSPSPL TSSLLLSIDE GCERPAADGY LSDGPHGAAA TMRERKKGVP  120
WSEQEHRLFL AGLEKLGKGD WRGISRSFVT TRTPTQVASH AQKFFLRHNS AAKKTNNKRR  180
SSLFDMVQDC DSGGRSLASS DPATRCNNNI SASLSLQVSH HKSGDSAWPS SETPSVSEAQ  240
QGHGYGTSHH CSPLDLELGM SLSTTPSIGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0598130.0AK059813.1 Oryza sativa Japonica Group cDNA clone:006-205-B05, full insert sequence.
GenBankAK0685950.0AK068595.1 Oryza sativa Japonica Group cDNA clone:J013154K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638259.10.0PREDICTED: transcription factor MYB1R1
TrEMBLI1PYG40.0I1PYG4_ORYGL; Uncharacterized protein
TrEMBLQ6I5E60.0Q6I5E6_ORYSJ; MYB-related transcription factor
STRINGLOC_Os05g51160.10.0(Oryza sativa Japonica Group)
STRINGORGLA05G0241200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-38MYB_related family protein